Lineage for d1n73c1 (1n73 C:138-404)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560074Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2560075Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2560076Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2560077Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2560166Species Sea lamprey (Petromyzon marinus), gamma [TaxId:7757] [75589] (2 PDB entries)
  8. 2560171Domain d1n73c1: 1n73 C:138-404 [80217]
    Other proteins in same PDB: d1n73a_, d1n73b2, d1n73c2, d1n73d_, d1n73e2, d1n73f2
    complexed with ca, nag

Details for d1n73c1

PDB Entry: 1n73 (more details), 2.9 Å

PDB Description: fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his- arg-pro-amide
PDB Compounds: (C:) Fibrin gamma chain

SCOPe Domain Sequences for d1n73c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n73c1 d.171.1.1 (C:138-404) Fibrinogen C-terminal domains {Sea lamprey (Petromyzon marinus), gamma [TaxId: 7757]}
cqdttankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhr
hdgsvnftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthry
adyghfkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdn
dkyegscaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwysl
kmttmkllpmgrdlsghggqqqskgns

SCOPe Domain Coordinates for d1n73c1:

Click to download the PDB-style file with coordinates for d1n73c1.
(The format of our PDB-style files is described here.)

Timeline for d1n73c1: