Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein) |
Protein Fibrinogen coiled-coil and central regions [58012] (4 species) in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [75698] (2 PDB entries) |
Domain d1n73b2: 1n73 B:163-218 [80216] Other proteins in same PDB: d1n73b1, d1n73c1, d1n73e1, d1n73f1 |
PDB Entry: 1n73 (more details), 2.9 Å
SCOP Domain Sequences for d1n73b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n73b2 h.1.8.1 (B:163-218) Fibrinogen coiled-coil and central regions {Sea lamprey (Petromyzon marinus)} aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapc
Timeline for d1n73b2: