Lineage for d1n73a_ (1n73 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3039950Protein Fibrinogen alpha chain [88887] (4 species)
  7. 3040007Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88891] (2 PDB entries)
  8. 3040008Domain d1n73a_: 1n73 A: [80214]
    Other proteins in same PDB: d1n73b1, d1n73b2, d1n73c1, d1n73c2, d1n73e1, d1n73e2, d1n73f1, d1n73f2
    coiled-coil region only
    complexed with ca, nag

Details for d1n73a_

PDB Entry: 1n73 (more details), 2.9 Å

PDB Description: fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his- arg-pro-amide
PDB Compounds: (A:) Fibrin alpha-1 chain

SCOPe Domain Sequences for d1n73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n73a_ h.1.8.1 (A:) Fibrinogen alpha chain {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
evlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrackgscaryl
eyrldkeknlqlekaasyianlkferfeevv

SCOPe Domain Coordinates for d1n73a_:

Click to download the PDB-style file with coordinates for d1n73a_.
(The format of our PDB-style files is described here.)

Timeline for d1n73a_: