Lineage for d1n72a_ (1n72 A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.2: Bromodomain [47370] (1 family) 
Family a.29.2.1: Bromodomain [47371] (4 proteins) 
Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47376] (7 PDB entries) 
Domain d1n72a_: 1n72 A: [80213]
Details for d1n72a_
PDB Entry: 1n72 (more details)
PDB Description: structure and ligand of a histone acetyltransferase bromodomain
PDB Compounds: (A:) histone acetyltransferaseSCOP Domain Sequences for d1n72a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n72a_ a.29.2.1 (A:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
mskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserl
knryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk
SCOP Domain Coordinates for d1n72a_:
Click to download the PDB-style file with coordinates for d1n72a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n72a_:
- d1n72a_ first appeared in SCOP 1.63
- d1n72a_ appears in SCOP 1.73
- d1n72a_ appears in SCOPe 2.01
- d1n72a_ appears in the current release, SCOPe 2.08, called d1n72a1
View in 3D