Lineage for d1n72a_ (1n72 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212790Fold a.29: Bromodomain-like [47363] (4 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 212791Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 212792Family a.29.2.1: Bromodomain [47371] (4 proteins)
  6. 212801Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 212802Species Human (Homo sapiens) [TaxId:9606] [47376] (2 PDB entries)
  8. 212803Domain d1n72a_: 1n72 A: [80213]

Details for d1n72a_

PDB Entry: 1n72 (more details)

PDB Description: structure and ligand of a histone acetyltransferase bromodomain

SCOP Domain Sequences for d1n72a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n72a_ a.29.2.1 (A:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens)}
mskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserl
knryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOP Domain Coordinates for d1n72a_:

Click to download the PDB-style file with coordinates for d1n72a_.
(The format of our PDB-style files is described here.)

Timeline for d1n72a_: