Lineage for d1n6wa_ (1n6w A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315136Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432
  4. 315137Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 315174Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 315185Protein Tyrosine phosphatase [52806] (8 species)
  7. 315186Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (48 PDB entries)
  8. 315197Domain d1n6wa_: 1n6w A: [80212]
    complexed with acy, mg, sna

Details for d1n6wa_

PDB Entry: 1n6w (more details), 2.15 Å

PDB Description: Crystal Structure of Protein Tyrosine Phosphatase 1B with Potent and Selective Bidentate Inhibitor Compound 2

SCOP Domain Sequences for d1n6wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6wa_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

SCOP Domain Coordinates for d1n6wa_:

Click to download the PDB-style file with coordinates for d1n6wa_.
(The format of our PDB-style files is described here.)

Timeline for d1n6wa_: