Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
Domain d1n6ql2: 1n6q L:108-211 [80210] Other proteins in same PDB: d1n6qa1, d1n6qa2, d1n6qb_, d1n6qh1, d1n6qh2, d1n6ql1 part of Fab 28 against HIV-1 RT complexed with atm, mg, mrg; mutant |
PDB Entry: 1n6q (more details), 3 Å
SCOP Domain Sequences for d1n6ql2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6ql2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1n6ql2: