| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (5 PDB entries) |
| Domain d1n6ql2: 1n6q L:108-211 [80210] Other proteins in same PDB: d1n6qa1, d1n6qa2, d1n6qb_, d1n6qh1, d1n6ql1 |
PDB Entry: 1n6q (more details), 3 Å
SCOP Domain Sequences for d1n6ql2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6ql2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1n6ql2: