Lineage for d1n6ql2 (1n6q L:108-211)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221239Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (5 PDB entries)
  8. 221243Domain d1n6ql2: 1n6q L:108-211 [80210]
    Other proteins in same PDB: d1n6qa1, d1n6qa2, d1n6qb_, d1n6qh1, d1n6ql1

Details for d1n6ql2

PDB Entry: 1n6q (more details), 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp- terminated dna (complex n)

SCOP Domain Sequences for d1n6ql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ql2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1n6ql2:

Click to download the PDB-style file with coordinates for d1n6ql2.
(The format of our PDB-style files is described here.)

Timeline for d1n6ql2: