Lineage for d1n6ql1 (1n6q L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653726Domain d1n6ql1: 1n6q L:1-107 [80209]
    Other proteins in same PDB: d1n6qa1, d1n6qa2, d1n6qb_, d1n6qh1, d1n6qh2, d1n6ql2
    part of Fab 28 against HIV-1 RT
    complexed with atm, mg, mrg; mutant

Details for d1n6ql1

PDB Entry: 1n6q (more details), 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp- terminated dna (complex n)
PDB Compounds: (L:) monoclonal antibody (light chain)

SCOP Domain Sequences for d1n6ql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ql1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
rfsgsgsgtdysltisnlepediatyycqqyskfpwtfgggtkleik

SCOP Domain Coordinates for d1n6ql1:

Click to download the PDB-style file with coordinates for d1n6ql1.
(The format of our PDB-style files is described here.)

Timeline for d1n6ql1: