SCOP 1.63: Domain d1n6ql1: 1n6q L:1-107

Lineage for d1n6ql1 (1n6q L:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (5 PDB entries)

8. Domain d1n6ql1: 1n6q L:1-107 [80209]
   Other proteins in same PDB: d1n6qa1, d1n6qa2, d1n6qb_, d1n6qh2, d1n6ql2

Details for d1n6ql1

PDB Entry: 1n6q, 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp- terminated dna (complex n)

SCOP Domain Sequences for d1n6ql1:

Sequence; same for both SEQRES and ATOM records:

>d1n6ql1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
rfsgsgsgtdysltisnlepediatyycqqyskfpwtfgggtkleik

Timeline for d1n6ql1:

• d1n6ql1 is new in SCOP 1.63
  
• d1n6ql1 appears in SCOP 1.65
  
• d1n6ql1 appears in the current release, SCOPe 2.08