Lineage for d1n6qh1 (1n6q H:1-123)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219437Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (5 PDB entries)
  8. 219440Domain d1n6qh1: 1n6q H:1-123 [80207]
    Other proteins in same PDB: d1n6qa1, d1n6qa2, d1n6qb_, d1n6qh2, d1n6ql2
    complexed with atm, mg, mrg; mutant

Details for d1n6qh1

PDB Entry: 1n6q (more details), 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp- terminated dna (complex n)

SCOP Domain Sequences for d1n6qh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6qh1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d1n6qh1:

Click to download the PDB-style file with coordinates for d1n6qh1.
(The format of our PDB-style files is described here.)

Timeline for d1n6qh1: