Lineage for d1n6qa1 (1n6q A:430-558)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859087Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1859138Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 1859148Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (101 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1859244Domain d1n6qa1: 1n6q A:430-558 [80204]
    Other proteins in same PDB: d1n6qa2, d1n6qb_, d1n6qh1, d1n6qh2, d1n6ql1, d1n6ql2
    protein/DNA complex; complexed with mg

Details for d1n6qa1

PDB Entry: 1n6q (more details), 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp- terminated dna (complex n)
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1n6qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6qa1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOPe Domain Coordinates for d1n6qa1:

Click to download the PDB-style file with coordinates for d1n6qa1.
(The format of our PDB-style files is described here.)

Timeline for d1n6qa1: