SCOP 1.71: Domain d1n6ha_: 1n6h A:

Lineage for d1n6ha_ (1n6h A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab5a [82399] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82400] (11 PDB entries)

8. Domain d1n6ha_: 1n6h A: [80197]
   complexed with bme, gnp, mg

Details for d1n6ha_

PDB Entry: 1n6h, 1.51 Å

PDB Description: Crystal Structure of Human Rab5a

SCOP Domain Sequences for d1n6ha_:

Sequence; same for both SEQRES and ATOM records:

>d1n6ha_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens)}
gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakkl

Timeline for d1n6ha_:

• d1n6ha_ first appeared in SCOP 1.63
  
• d1n6ha_ appears in SCOP 1.69
  
• d1n6ha_ appears in SCOP 1.73
  
• d1n6ha_ appears in the current release, SCOPe 2.08