Class b: All beta proteins [48724] (126 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.9: Tricorn protease domain 2 [69322] (1 family) distorted 7-bladed beta-propeller fold; possibly related to the N-terminal domain of tricorn protease (a 6-bladed beta-propeller) |
Family b.69.9.1: Tricorn protease domain 2 [69323] (1 protein) |
Protein Tricorn protease domain 2 [69324] (1 species) |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69325] (4 PDB entries) |
Domain d1n6fd3: 1n6f D:320-679 [80187] Other proteins in same PDB: d1n6fa1, d1n6fa2, d1n6fa4, d1n6fb1, d1n6fb2, d1n6fb4, d1n6fc1, d1n6fc2, d1n6fc4, d1n6fd1, d1n6fd2, d1n6fd4, d1n6fe1, d1n6fe2, d1n6fe4, d1n6ff1, d1n6ff2, d1n6ff4 |
PDB Entry: 1n6f (more details), 2.7 Å
SCOP Domain Sequences for d1n6fd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6fd3 b.69.9.1 (D:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum} sipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafih gtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkpt viersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattensh dyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsm tseageydlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvl lkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplv
Timeline for d1n6fd3: