Class b: All beta proteins [48724] (119 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller) |
Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein) |
Protein Tricorn protease N-terminal domain [69306] (1 species) |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries) |
Domain d1n6db2: 1n6d B:39-319 [80130] Other proteins in same PDB: d1n6da1, d1n6da3, d1n6da4, d1n6db1, d1n6db3, d1n6db4, d1n6dc1, d1n6dc3, d1n6dc4, d1n6dd1, d1n6dd3, d1n6dd4, d1n6de1, d1n6de3, d1n6de4, d1n6df1, d1n6df3, d1n6df4 |
PDB Entry: 1n6d (more details), 2.8 Å
SCOP Domain Sequences for d1n6db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6db2 b.68.7.1 (B:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum} mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl ntdgrrilfskggsiyifnpdtekiekieigdlespedrii
Timeline for d1n6db2: