Lineage for d1n64l1 (1n64 L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219057Species Anti-HCV Fab 19D9D6, (mouse), kappa L chain [81947] (3 PDB entries)
  8. 219065Domain d1n64l1: 1n64 L:1-107 [80116]
    Other proteins in same PDB: d1n64h2, d1n64l2

Details for d1n64l1

PDB Entry: 1n64 (more details), 2.34 Å

PDB Description: Crystal structure analysis of the immunodominant antigenic site on Hepatitis C virus protein bound to mAb 19D9D6

SCOP Domain Sequences for d1n64l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n64l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-HCV Fab 19D9D6, (mouse), kappa L chain}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelk

SCOP Domain Coordinates for d1n64l1:

Click to download the PDB-style file with coordinates for d1n64l1.
(The format of our PDB-style files is described here.)

Timeline for d1n64l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n64l2