SCOP 1.67: Domain d1n64h1: 1n64 H:1-113

Lineage for d1n64h1 (1n64 H:1-113)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (29 PDB entries)

8. Domain d1n64h1: 1n64 H:1-113 [80114]
   Other proteins in same PDB: d1n64h2, d1n64l1, d1n64l2
   part of anti-HCV Fab 19D9D6; complex with peptide, chain P (related to 1cwx)

Details for d1n64h1

PDB Entry: 1n64, 2.34 Å

PDB Description: Crystal structure analysis of the immunodominant antigenic site on Hepatitis C virus protein bound to mAb 19D9D6

SCOP Domain Sequences for d1n64h1:

Sequence; same for both SEQRES and ATOM records:

>d1n64h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvss

Timeline for d1n64h1:

• d1n64h1 first appeared in SCOP 1.63
  
• d1n64h1 appears in SCOP 1.65
  
• d1n64h1 appears in SCOP 1.69
  
• d1n64h1 appears in the current release, SCOPe 2.08