SCOPe 2.01: Domain d1n63d2: 1n63 D:3-81

Lineage for d1n63d2 (1n63 D:3-81)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)

6. Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)

7. Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54321] (5 PDB entries)

8. Domain d1n63d2: 1n63 D:3-81 [80109]
   Other proteins in same PDB: d1n63a1, d1n63b1, d1n63b2, d1n63c1, d1n63c2, d1n63d1, d1n63e1, d1n63e2, d1n63f1, d1n63f2
   complexed with cun, fad, fes, mcn, po4

Details for d1n63d2

PDB Entry: 1n63, 1.21 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state

PDB Compounds: (D:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1n63d2:

Sequence; same for both SEQRES and ATOM records:

>d1n63d2 d.15.4.2 (D:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

Timeline for d1n63d2:

• d1n63d2 first appeared in SCOP 1.63
  
• d1n63d2 appears in SCOP 1.75
  
• d1n63d2 appears in SCOPe 2.02
  
• d1n63d2 appears in the current release, SCOPe 2.08