Lineage for d1n61d1 (1n61 D:82-160)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642696Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 642697Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 642698Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)
  6. 642712Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 642720Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [47749] (5 PDB entries)
  8. 642728Domain d1n61d1: 1n61 D:82-160 [80084]
    Other proteins in same PDB: d1n61a2, d1n61b1, d1n61b2, d1n61c1, d1n61c2, d1n61d2, d1n61e1, d1n61e2, d1n61f1, d1n61f2
    complexed with cun, fad, fes, mcn, po4

Details for d1n61d1

PDB Entry: 1n61 (more details), 1.3 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Dithionite reduced state
PDB Compounds: (D:) Carbon monoxide dehydrogenase small chain

SCOP Domain Sequences for d1n61d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n61d1 a.56.1.1 (D:82-160) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvp

SCOP Domain Coordinates for d1n61d1:

Click to download the PDB-style file with coordinates for d1n61d1.
(The format of our PDB-style files is described here.)

Timeline for d1n61d1: