Lineage for d1n5yl2 (1n5y L:108-211)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934293Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 934519Species Mouse (Mus musculus) [TaxId:10090] [88567] (318 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 934891Domain d1n5yl2: 1n5y L:108-211 [80063]
    Other proteins in same PDB: d1n5ya1, d1n5ya2, d1n5yb_, d1n5yh1, d1n5yh2, d1n5yl1
    part of Fab 28 against HIV-1 RT
    protein/DNA complex; complexed with mg

Details for d1n5yl2

PDB Entry: 1n5y (more details), 3.1 Å

PDB Description: HIV-1 Reverse Transcriptase Crosslinked to Post-Translocation AZTMP-Terminated DNA (Complex P)
PDB Compounds: (L:) monoclonal antibody (light chain)

SCOPe Domain Sequences for d1n5yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5yl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d1n5yl2:

Click to download the PDB-style file with coordinates for d1n5yl2.
(The format of our PDB-style files is described here.)

Timeline for d1n5yl2: