SCOP 1.63: Domain d1n5yl2: 1n5y L:108-211

Lineage for d1n5yl2 (1n5y L:108-211)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (5 PDB entries)

8. Domain d1n5yl2: 1n5y L:108-211 [80063]
   Other proteins in same PDB: d1n5ya1, d1n5ya2, d1n5yb_, d1n5yh1, d1n5yl1

Details for d1n5yl2

PDB Entry: 1n5y, 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to post-translocation aztmp- terminated dna (complex p)

SCOP Domain Sequences for d1n5yl2:

Sequence; same for both SEQRES and ATOM records:

>d1n5yl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1n5yl2:

• d1n5yl2 is new in SCOP 1.63
  
• d1n5yl2 appears in SCOP 1.65
  
• d1n5yl2 appears in the current release, SCOPe 2.08