Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (2 proteins) |
Protein HIV-1 reverse transcriptase [56689] (2 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (78 PDB entries) |
Domain d1n5yb_: 1n5y B: [80059] Other proteins in same PDB: d1n5ya1, d1n5yh1, d1n5yh2, d1n5yl1, d1n5yl2 |
PDB Entry: 1n5y (more details), 3.1 Å
SCOP Domain Sequences for d1n5yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5yb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp plvklwyql
Timeline for d1n5yb_: