Lineage for d1n5yb_ (1n5y B:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339256Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 339257Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 339321Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 339322Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 339323Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (63 PDB entries)
  8. 339434Domain d1n5yb_: 1n5y B: [80059]
    Other proteins in same PDB: d1n5ya1, d1n5yh1, d1n5yh2, d1n5yl1, d1n5yl2
    complexed with atm, mg, mrg; mutant

Details for d1n5yb_

PDB Entry: 1n5y (more details), 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to post-translocation aztmp- terminated dna (complex p)

SCOP Domain Sequences for d1n5yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5yb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOP Domain Coordinates for d1n5yb_:

Click to download the PDB-style file with coordinates for d1n5yb_.
(The format of our PDB-style files is described here.)

Timeline for d1n5yb_: