Lineage for d1n5ya2 (1n5y A:1-429)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424541Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 424542Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 424543Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (71 PDB entries)
  8. 424661Domain d1n5ya2: 1n5y A:1-429 [80058]
    Other proteins in same PDB: d1n5ya1, d1n5yh1, d1n5yh2, d1n5yl1, d1n5yl2
    complexed with atm, mg, mrg; mutant

Details for d1n5ya2

PDB Entry: 1n5y (more details), 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to post-translocation aztmp- terminated dna (complex p)

SCOP Domain Sequences for d1n5ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ya2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOP Domain Coordinates for d1n5ya2:

Click to download the PDB-style file with coordinates for d1n5ya2.
(The format of our PDB-style files is described here.)

Timeline for d1n5ya2: