Lineage for d1n59c1 (1n59 C:182-276)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 932877Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 932996Domain d1n59c1: 1n59 C:182-276 [80011]
    Other proteins in same PDB: d1n59a2, d1n59b_, d1n59c2, d1n59d_

Details for d1n59c1

PDB Entry: 1n59 (more details), 2.95 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
PDB Compounds: (C:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1n59c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n59c1 b.1.1.2 (C:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwep

SCOPe Domain Coordinates for d1n59c1:

Click to download the PDB-style file with coordinates for d1n59c1.
(The format of our PDB-style files is described here.)

Timeline for d1n59c1: