SCOP 1.63: Domain d1n59c1: 1n59 C:182-276

Lineage for d1n59c1 (1n59 C:182-276)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)

8. Domain d1n59c1: 1n59 C:182-276 [80011]
   Other proteins in same PDB: d1n59a2, d1n59c2
   mutant

Details for d1n59c1

PDB Entry: 1n59, 2.95 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

SCOP Domain Sequences for d1n59c1:

Sequence; same for both SEQRES and ATOM records:

>d1n59c1 b.1.1.2 (C:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwep

Timeline for d1n59c1:

• d1n59c1 is new in SCOP 1.63
  
• d1n59c1 appears in SCOP 1.65
  
• d1n59c1 appears in the current release, SCOPe 2.08