Lineage for d1n59c1 (1n59 C:182-276)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220647Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)
  8. 220688Domain d1n59c1: 1n59 C:182-276 [80011]
    Other proteins in same PDB: d1n59a2, d1n59c2
    mutant

Details for d1n59c1

PDB Entry: 1n59 (more details), 2.95 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

SCOP Domain Sequences for d1n59c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n59c1 b.1.1.2 (C:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwep

SCOP Domain Coordinates for d1n59c1:

Click to download the PDB-style file with coordinates for d1n59c1.
(The format of our PDB-style files is described here.)

Timeline for d1n59c1: