Lineage for d1n54b_ (1n54 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195067Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)
  7. 2195068Species Human (Homo sapiens) [TaxId:9606] [64275] (7 PDB entries)
  8. 2195078Domain d1n54b_: 1n54 B: [80006]
    Other proteins in same PDB: d1n54a1, d1n54a2, d1n54a3
    protein/RNA complex; complexed with gol

Details for d1n54b_

PDB Entry: 1n54 (more details), 2.72 Å

PDB Description: Cap Binding Complex m7GpppG free
PDB Compounds: (B:) 20 kda nuclear cap binding protein

SCOPe Domain Sequences for d1n54b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n54b_ d.58.7.1 (B:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
lkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsksgd
ikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegrqy
g

SCOPe Domain Coordinates for d1n54b_:

Click to download the PDB-style file with coordinates for d1n54b_.
(The format of our PDB-style files is described here.)

Timeline for d1n54b_: