Lineage for d1n54b_ (1n54 B:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (14 proteins) 
Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64275] (6 PDB entries) 
Domain d1n54b_: 1n54 B: [80006]
Other proteins in same PDB: d1n54a1, d1n54a2, d1n54a3
complexed with gol
Details for d1n54b_
PDB Entry: 1n54 (more details), 2.72 Å
PDB Description: Cap Binding Complex m7GpppG free
SCOP Domain Sequences for d1n54b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n54b_ d.58.7.1 (B:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens)}
lkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsksgd
ikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegrqy
g
SCOP Domain Coordinates for d1n54b_:
Click to download the PDB-style file with coordinates for d1n54b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n54b_:
- d1n54b_ is new in SCOP 1.63
- d1n54b_ appears in SCOP 1.65
- d1n54b_ appears in the current release, SCOPe 2.08
View in 3D
