SCOPe 2.08: Domain d1n4mb1: 1n4m B:380-581

Lineage for d1n4mb1 (1n4m B:380-581)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)

8. Domain d1n4mb1: 1n4m B:380-581 [79996]
   bound to the transactivation domain (peptide) of E2F-2
   has additional insertions and/or extensions that are not grouped together

Details for d1n4mb1

PDB Entry: 1n4m, 2.2 Å

PDB Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2

PDB Compounds: (B:) Retinoblastoma Pocket

SCOPe Domain Sequences for d1n4mb1:

Sequence, based on SEQRES records:

>d1n4mb1 a.74.1.3 (B:380-581) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
slawlsdsplfdlikqsktreg

Sequence, based on observed residues (ATOM records):

>d1n4mb1 a.74.1.3 (B:380-581) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
rsttdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawlsd
splfdlikqsktreg

Timeline for d1n4mb1:

• d1n4mb1 first appeared in SCOP 1.63
  
• d1n4mb1 appears in SCOPe 2.07