Lineage for d1n49d_ (1n49 D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231370Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 231371Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 231372Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 231388Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 231389Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (151 PDB entries)
  8. 231648Domain d1n49d_: 1n49 D: [79990]
    complexed with rit; mutant

Details for d1n49d_

PDB Entry: 1n49 (more details), 2.2 Å

PDB Description: viability of a drug-resistant hiv-1 protease variant: structural insights for better anti-viral therapy

SCOP Domain Sequences for d1n49d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n49d_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpaniigrnlltqigctlnf

SCOP Domain Coordinates for d1n49d_:

Click to download the PDB-style file with coordinates for d1n49d_.
(The format of our PDB-style files is described here.)

Timeline for d1n49d_: