Lineage for d1n3ub_ (1n3u B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448927Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 448928Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 448929Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 448941Protein Heme oxygenase-1 (HO-1) [48615] (2 species)
  7. 448942Species Human (Homo sapiens) [TaxId:9606] [48616] (12 PDB entries)
  8. 448968Domain d1n3ub_: 1n3u B: [79974]

Details for d1n3ub_

PDB Entry: 1n3u (more details), 2.58 Å

PDB Description: Crystal structure of human heme oxygenase 1 (HO-1) in complex with its substrate heme, crystal form B

SCOP Domain Sequences for d1n3ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3ub_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1n3ub_:

Click to download the PDB-style file with coordinates for d1n3ub_.
(The format of our PDB-style files is described here.)

Timeline for d1n3ub_: