SCOPe 2.01: Domain d1n3ua_: 1n3u A:

Lineage for d1n3ua_ (1n3u A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (23 PDB entries)
   Uniprot P09601

8. Domain d1n3ua_: 1n3u A: [79973]
   complexed with cl, hem

Details for d1n3ua_

PDB Entry: 1n3u, 2.58 Å

PDB Description: Crystal structure of human heme oxygenase 1 (HO-1) in complex with its substrate heme, crystal form B

PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1n3ua_:

Sequence; same for both SEQRES and ATOM records:

>d1n3ua_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1n3ua_:

• d1n3ua_ first appeared in SCOP 1.63
  
• d1n3ua_ appears in SCOP 1.75
  
• d1n3ua_ appears in SCOPe 2.02
  
• d1n3ua_ appears in the current release, SCOPe 2.08