Lineage for d1n3ua_ (1n3u A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361144Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 361145Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 361146Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 361155Protein Heme oxygenase-1 (HO-1) [48615] (2 species)
  7. 361156Species Human (Homo sapiens) [TaxId:9606] [48616] (9 PDB entries)
  8. 361173Domain d1n3ua_: 1n3u A: [79973]

Details for d1n3ua_

PDB Entry: 1n3u (more details), 2.58 Å

PDB Description: Crystal structure of human heme oxygenase 1 (HO-1) in complex with its substrate heme, crystal form B

SCOP Domain Sequences for d1n3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3ua_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1n3ua_:

Click to download the PDB-style file with coordinates for d1n3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1n3ua_: