Lineage for d1n36t_ (1n36 T:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636765Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 636766Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 636767Protein Ribosomal protein S20 [46994] (1 species)
  7. 636768Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries)
  8. 636793Domain d1n36t_: 1n36 T: [79956]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36v_
    complexed with zn

Details for d1n36t_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position
PDB Compounds: (T:) 30S ribosomal protein S20

SCOP Domain Sequences for d1n36t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1n36t_:

Click to download the PDB-style file with coordinates for d1n36t_.
(The format of our PDB-style files is described here.)

Timeline for d1n36t_: