![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
![]() | Domain d1n36r_: 1n36 R: [79954] Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36s_, d1n36t_, d1n36v_ complexed with zn |
PDB Entry: 1n36 (more details), 3.65 Å
SCOPe Domain Sequences for d1n36r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n36r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d1n36r_: