Lineage for d1n36o_ (1n36 O:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311142Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2311143Protein Ribosomal protein S15 [47065] (3 species)
  7. 2311157Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 2311187Domain d1n36o_: 1n36 O: [79951]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36o_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1n36o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1n36o_:

Click to download the PDB-style file with coordinates for d1n36o_.
(The format of our PDB-style files is described here.)

Timeline for d1n36o_: