SCOP 1.73: Domain d1n36n_: 1n36 N:

Lineage for d1n36n_ (1n36 N:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)

8. Domain d1n36n_: 1n36 N: [79950]
   Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
   complexed with zn

Details for d1n36n_

PDB Entry: 1n36, 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d1n36n_:

Sequence; same for both SEQRES and ATOM records:

>d1n36n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1n36n_:

• d1n36n_ first appeared in SCOP 1.63
  
• d1n36n_ appears in SCOP 1.71
  
• d1n36n_ appears in SCOP 1.75
  
• d1n36n_ appears in the current release, SCOPe 2.08