![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50303] (14 PDB entries) |
![]() | Domain d1n36l_: 1n36 L: [79948] Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_ complexed with zn |
PDB Entry: 1n36 (more details), 3.65 Å
SCOP Domain Sequences for d1n36l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n36l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d1n36l_: