Lineage for d1n36k_ (1n36 K:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488796Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 488797Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 488823Protein Ribosomal protein S11 [53141] (1 species)
  7. 488824Species Thermus thermophilus [TaxId:274] [53142] (14 PDB entries)
  8. 488837Domain d1n36k_: 1n36 K: [79947]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_

Details for d1n36k_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d1n36k_:

Click to download the PDB-style file with coordinates for d1n36k_.
(The format of our PDB-style files is described here.)

Timeline for d1n36k_: