Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (2 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (1 species) |
Species Thermus thermophilus [TaxId:274] [53142] (14 PDB entries) |
Domain d1n36k_: 1n36 K: [79947] Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_ |
PDB Entry: 1n36 (more details), 3.65 Å
SCOP Domain Sequences for d1n36k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n36k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus} krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
Timeline for d1n36k_: