Lineage for d1n36e2 (1n36 E:5-73)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602557Fold d.50: dsRBD-like [54767] (4 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 602558Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 602593Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 602594Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
    lacks the N-terminal helix
  7. 602597Species Thermus thermophilus [TaxId:274] [54781] (18 PDB entries)
  8. 602614Domain d1n36e2: 1n36 E:5-73 [79941]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36e2

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d1n36e2:

Click to download the PDB-style file with coordinates for d1n36e2.
(The format of our PDB-style files is described here.)

Timeline for d1n36e2: