![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries) Uniprot P80372 |
![]() | Domain d1n36c1: 1n36 C:2-106 [79937] Other proteins in same PDB: d1n36b_, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_ complexed with zn |
PDB Entry: 1n36 (more details), 3.65 Å
SCOPe Domain Sequences for d1n36c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n36c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1n36c1: