Lineage for d1n34r_ (1n34 R:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1080920Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1080921Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1080922Protein Ribosomal protein S18 [46913] (2 species)
  7. 1080948Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1080977Domain d1n34r_: 1n34 R: [79931]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34r_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1n34r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d1n34r_:

Click to download the PDB-style file with coordinates for d1n34r_.
(The format of our PDB-style files is described here.)

Timeline for d1n34r_: