Lineage for d1n34o_ (1n34 O:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534943Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 534944Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 534951Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 534952Protein Ribosomal protein S15 [47065] (2 species)
  7. 534955Species Thermus thermophilus [TaxId:274] [47067] (23 PDB entries)
  8. 534972Domain d1n34o_: 1n34 O: [79928]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34o_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position

SCOP Domain Sequences for d1n34o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1n34o_:

Click to download the PDB-style file with coordinates for d1n34o_.
(The format of our PDB-style files is described here.)

Timeline for d1n34o_: