SCOP 1.73: Domain d1n34n_: 1n34 N:

Lineage for d1n34n_ (1n34 N:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)

8. Domain d1n34n_: 1n34 N: [79927]
   Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
   complexed with zn

Details for d1n34n_

PDB Entry: 1n34, 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d1n34n_:

Sequence; same for both SEQRES and ATOM records:

>d1n34n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1n34n_:

• d1n34n_ first appeared in SCOP 1.63
  
• d1n34n_ appears in SCOP 1.71
  
• d1n34n_ appears in SCOP 1.75
  
• d1n34n_ appears in the current release, SCOPe 2.08