Lineage for d1n34j_ (1n34 J:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504964Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 504965Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 504966Protein Ribosomal protein S10 [55001] (1 species)
  7. 504967Species Thermus thermophilus [TaxId:274] [55002] (14 PDB entries)
  8. 504978Domain d1n34j_: 1n34 J: [79923]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_

Details for d1n34j_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position

SCOP Domain Sequences for d1n34j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1n34j_:

Click to download the PDB-style file with coordinates for d1n34j_.
(The format of our PDB-style files is described here.)

Timeline for d1n34j_: