Lineage for d1n34f_ (1n34 F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909830Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1909831Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1909832Protein Ribosomal protein S6 [54997] (4 species)
  7. 1909862Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1909896Domain d1n34f_: 1n34 F: [79919]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34f_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1n34f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1n34f_:

Click to download the PDB-style file with coordinates for d1n34f_.
(The format of our PDB-style files is described here.)

Timeline for d1n34f_: