![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
![]() | Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
![]() | Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species) lacks the N-terminal helix |
![]() | Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) |
![]() | Domain d1n34e2: 1n34 E:5-73 [79918] Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_ complexed with zn |
PDB Entry: 1n34 (more details), 3.8 Å
SCOP Domain Sequences for d1n34e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n34e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d1n34e2: