Lineage for d1n33t_ (1n33 T:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278620Fold a.7: Spectrin repeat-like [46965] (8 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 278706Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 278707Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 278708Protein Ribosomal protein S20 [46994] (1 species)
  7. 278709Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries)
  8. 278718Domain d1n33t_: 1n33 T: [79911]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33t_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin

SCOP Domain Sequences for d1n33t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1n33t_:

Click to download the PDB-style file with coordinates for d1n33t_.
(The format of our PDB-style files is described here.)

Timeline for d1n33t_: