Lineage for d1n33s_ (1n33 S:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186446Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 2186447Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 2186448Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 2186449Protein Ribosomal protein S19 [54572] (2 species)
  7. 2186477Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 2186498Domain d1n33s_: 1n33 S: [79910]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33t_, d1n33v_
    complexed with mg, par, zn

Details for d1n33s_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1n33s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1n33s_:

Click to download the PDB-style file with coordinates for d1n33s_.
(The format of our PDB-style files is described here.)

Timeline for d1n33s_: