Lineage for d1n33r_ (1n33 R:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 278372Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 278373Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 278374Protein Ribosomal protein S18 [46913] (1 species)
  7. 278375Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries)
  8. 278384Domain d1n33r_: 1n33 R: [79909]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33r_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin

SCOP Domain Sequences for d1n33r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1n33r_:

Click to download the PDB-style file with coordinates for d1n33r_.
(The format of our PDB-style files is described here.)

Timeline for d1n33r_: